PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.3726s0010.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 313aa    MW: 34770.9 Da    PI: 6.056
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.3726s0010.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like81.41.1e-25163216155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          +pr+r +peLHerF+eav++L G+ekAtPk++++lm+v++Lt+++vkSHLQ YRl
  Araha.3726s0010.1.p 163 RPRMRSSPELHERFLEAVNKLEGPEKATPKAVMKLMNVESLTIYQVKSHLQ-YRL 216
                          59************************************************9.776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.1E-23162217IPR009057Homeodomain-like
SuperFamilySSF466891.0E-11163215IPR009057Homeodomain-like
TIGRFAMsTIGR015576.6E-18164215IPR006447Myb domain, plants
PfamPF002497.8E-6169214IPR001005SANT/Myb domain
PfamPF143792.5E-9252288IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MNSHSLLSMD GGNNAYCSSS LSPSPLLNFL NTNYLPLETR DFSKGSFSRS SAFCNLSSSS  60
SSDTQKHLGT TLPFLPNPPT ETTSPLTFTE DLLLSSTPCH GGDSAFLTLY GDFLSDELQL  120
AITDRAETPR LDDIYQVNHG QNCVPAAMSV TTEPSPGSAV NHRPRMRSSP ELHERFLEAV  180
NKLEGPEKAT PKAVMKLMNV ESLTIYQVKS HLQYRLAKYM PERKPEENGN SEEKKPASNT  240
NEADGRKKGA IQLTEALRMQ MEVQRSLQLQ IEEHAKYLEN ILEEQHKSCK TDASEAKDDK  300
CETSRKRPRL EN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013590547.11e-126PREDICTED: protein PHR1-LIKE 1-like
TrEMBLA0A0D3CR461e-126A0A0D3CR46_BRAOL; Uncharacterized protein
STRINGBra038033.1-P1e-119(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM1913667
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13040.22e-91G2-like family protein